PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_010116-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 274aa    MW: 30692.7 Da    PI: 8.6598
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_010116-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.11.5e-18120174256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  AHYPO_010116-RA 120 RKKLRLTKEQSVLLEESFKQQSTLNPKQKQALADRLNLRPRQVEVWFQNRRARTK 174
                      78889************************************************98 PP

2HD-ZIP_I/II121.54.3e-39120208190
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                      +kk+rl+keq+ lLEesF+++++L+p++K++la +L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +
  AHYPO_010116-RA 120 RKKLRLTKEQSVLLEESFKQQSTLNPKQKQALADRLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKKCCETLTDENRRLQKELQELK-A 208
                      69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-18106174IPR009057Homeodomain-like
SuperFamilySSF466891.17E-18107177IPR009057Homeodomain-like
PROSITE profilePS5007117.2116176IPR001356Homeobox domain
SMARTSM003892.1E-15118180IPR001356Homeobox domain
CDDcd000863.34E-15119177No hitNo description
PfamPF000466.6E-16120174IPR001356Homeobox domain
PROSITE patternPS000270151174IPR017970Homeobox, conserved site
SMARTSM003401.1E-25176219IPR003106Leucine zipper, homeobox-associated
PfamPF021835.7E-10176210IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MVSPSEDQAL TLGLGISYST KTITSKNNNP VKQPHVRVYD HEPSLALSLS GETYQTVERK  60
VRIDHQETPC SVSVASSLSN VVSVKRERES ASSDDLEMER GCSRISDEDE DGSGPTNTPR  120
KKLRLTKEQS VLLEESFKQQ STLNPKQKQA LADRLNLRPR QVEVWFQNRR ARTKLKQTEV  180
DCEYLKKCCE TLTDENRRLQ KELQELKALK LGQPFYMQLP AATLTMCPSC ERIGATTGVN  240
PASSTNPSTN SKTIGIKSHF NYPPQQIRPL LVD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1168176RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010680788.11e-146PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466041e-79HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A0J8CAL11e-146A0A0J8CAL1_BETVU; Uncharacterized protein
STRINGVIT_00s0732g00010.t012e-92(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.18e-69HD-ZIP family protein